Active Recombinant Mouse IFNG Protein

Cat.No. : IFNG-116M
Product Overview : Recombinant Mouse IFNG Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Interferon gamma (IFN-γ) is a type II interferon that is critical during adaptive and innate immune responses to infection. IFN-γ is produced by T cells and natural killer cells following antigen-specific activation. IFN-γ binds IFN-γ receptors (IFN-γ R1 and IFN-γ R2), which are expressed on most immune cells, to activate the JAK-STAT pathway. IFN-γ-induced signaling increases the expression of class 1 major histocompatibility complex (MHC) molecules. Mouse IFN-γ is not cross-reactive with human IFN-γ.
Source : E. coli
Species : Mouse
Bio-activity : Viral CPE assay using EMC virus on L929 cells, ≥1.0 x 10^7 units/mg
Molecular Mass : Monomer, 15.7 kDa (134 aa)
AA Sequence : MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Ifng interferon gamma [ Mus musculus (house mouse) ]
Official Symbol IFNG
Synonyms IFNG; interferon gamma; IFN-gamma; gamma interferon; Ifg; IFN-g;
Gene ID 15978
mRNA Refseq NM_008337
Protein Refseq NP_032363
UniProt ID P01580

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IFNG Products

Required fields are marked with *

My Review for All IFNG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon