Active Recombinant Mouse Cd40lg Protein

• Cat.No.: Cd40lg-2063M
• Product Overview: Purified recombinant protein of Mouse CD40 ligand (Cd40lg) without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B. Induces the activation of kinases MAPK8 and PAK2 in T-cells. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching.
• Bio-activity: Determined by its ability to induce TNF-alpha; and MIP-1alpha; production by murine splenocytes. The expected ED50 for this effect is > 0.1 μg/mL.
• Molecular Mass: 16.4 kDa
• AA Sequence: MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Cd40lg CD40 ligand [ Mus musculus (house mouse) ]
• Official Symbol: Cd40lg
• Synonyms: Cd40lg; CD40 ligand; IGM; IMD; gp3; Cd40; HIGM; IMD3; Ly-6; Ly62; T-BA; TRAP; Tnfs; gp39; CD154; Cd40l; HIGM1; Ly-62; T-BAM; CD40-L; Tnfsf5; Tnlg8b; CD40 ligand; T-cell antigen Gp39; TNF-related activation protein; tumor necrosis factor ligand 8b; tumor necrosis factor ligand superfamily member 5
• Gene ID: 21947
• mRNA Refseq: NM_011616
• Protein Refseq: NP_035746
• UniProt ID: P27548