Active Recombinant Human TDGF1 protein, T7/His-tagged

• Cat.No.: TDGF1-78H
• Product Overview: Recombinant human Cripto-1 cDNA (31-150aa, isoform-1, derived from BC067844) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 31-150 a.a.
• Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• Bio-activity: Measured by its binding ability in a functional ELSA. Immobilized recombinant human Nodal protein at 2ug/ml (100ul/well) can bind rhCripto-1 with a linear range of 0.5-100 ng/ml.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSK ELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro Cripto-1/Nodal signaling pathway regulations study for mesoderm differentiation.2. Potential biomarker protein for various cancer diagnostic developments.3. May be used as antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ]
• Official Symbol: TDGF1
• Synonyms: TDGF1; teratocarcinoma-derived growth factor 1; CR; CRIPTO; Cripto 1; cripto-1 growth factor; epidermal growth factor-like cripto protein CR1; CRGF
• Gene ID: 6997
• mRNA Refseq: NM_001174136
• Protein Refseq: NP_001167607
• UniProt ID: P13385
• Chromosome Location: 3p21.31
• Pathway: Developmental Biology, organism-specific biosystem; Glypican 1 network, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem
• Function: growth factor activity; protein binding; receptor binding