Active Recombinant Human TDGF1, Fc-tagged

Cat.No. : TDGF1-27821TH
Product Overview : Recombinant fragment, corresponding to amino acids 31-169 of Human Cripto1 fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modified human 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Modified human 293 cells
Tag : Fc
ProteinLength : 31-169 a.a.
Description : This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants.
Conjugation : Fc
Tissue specificity : Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts.
Biological activity : 200 ng/ml of this Chimera induces ERK1 and ERK2 phosphorylation in human umbilical vein endothelial (HUVEC) cells.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : Theoretical sequence:LGHQEFARPSRGYLAFRDDSIWPQEEPAI RPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCAC PPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWH GQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
Sequence Similarities : Contains 1 EGF-like domain.
Gene Name TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ]
Official Symbol TDGF1
Synonyms TDGF1; teratocarcinoma-derived growth factor 1; CR; CRIPTO; Cripto 1;
Gene ID 6997
mRNA Refseq NM_001174136
Protein Refseq NP_001167607
Uniprot ID P13385
Chromosome Location 3p21.31
Pathway Developmental Biology, organism-specific biosystem; Glypican 1 network, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem;
Function growth factor activity; protein binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TDGF1 Products

Required fields are marked with *

My Review for All TDGF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon