Active Recombinant Human TDGF1, Fc Chimera

• Cat.No.: TDGF1-496H
• Product Overview: Recombinant Human Teratocarcinoma-Derived Growth Factor 1 encoding the signal peptide and extracellular domain of human Cripto-1 (aa 1-169) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modifiedhuman 293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Description: Cripto-1 (CR-1), also known as teratocarcinoma-derived growth factor-1 (TDGF-1), is a small glycoprotein that contains a single divergent EGF-like motif as well as a novel cysteine-rich domain termed the Cripto motif. It is the founding member of the EGF-CFC gene family, which is conserved among vertebrates, with homologs in chick, frogs, and zebrafish.
• Amino Acid Sequence: LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCM LGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPG CDGLVMDEHLVASRTPELPPSGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK.
• Molecular Mass: Under reducing conditions Cripto-1 – Fc Chimera migrates as a broad band between 45 and 55 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Cripto-1 - Fc Chimera that has a predicted monomeric molecular mass of 42.8 kDa.
• pI: Cripto-1 – Fc Chimera separates into a number of glycoforms with an observed pI between 6.5 and 10 on 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Cripto-1 - Fc Chimera that has a predicted pI of 8.2.
• % Carbohydrate: Purified Cripto-1 – Fc Chimera consists of 5-30% carbohydrate by weight.
• Glycosylation: Cripto-1 – Fc Chimera contains N-linked and O-linked oligosaccharides.
• Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Briliant Blue.
• Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
• Activity: 200 ng/ml Cripto-1 – Fc Chimera induces ERK1 and ERK2 phosphorylation in human umbilical vein endothelial (HUVEC) cells

Gene Information

• Gene Name: TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ]
• Synonyms: TDGF1; teratocarcinoma-derived growth factor 1; CR; CRGF; CRIPTO; Cripto-1; Epidermal growth factor-like cripto protein CR1; Cripto-1 growth factor
• Gene ID: 6997
• mRNA Refseq: NM_003212
• Protein Refseq: NP_003203
• UniProt ID: P13385
• Chromosome Location: 3p21.31
• MIM: 187395
• Function: growth factor activity