Active Recombinant Human RSPO1, Fc-tagged, Biotinylated

• Cat.No.: RSPO1-670H
• Product Overview: The recombinant human RPSO1-Fc fusion is expressed as a 481 amino acid protein consisting of Ser21 - Ala263 region of (UniProt accession #Q2MKA7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Synergizes with Wnt3a to stabilize β-catenin protein levels and induces the activation of β-catenin responsive Luciferase reporter gene in HEK293 cells with a typical ED50 of 50 - 200 ng/ml.
• Molecular Mass: Calculated molecular mass (kDa): 53.5; Estimated by SDS-PAGE under reducing condition (kDa): 55-60.
• AA Sequence: SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCI KCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFR RGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRK GQQQQQQQGTVGPLTSAGPASTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 21-263 a.a.

Gene Information

• Gene Name: RSPO1 R-spondin 1 [ Homo sapiens ]
• Official Symbol: RSPO1
• Synonyms: RSPO1; R-spondin 1; R spondin homolog (Xenopus laevis); R-spondin-1; FLJ40906; RSPONDIN; R-spondin homolog; roof plate-specific spondin-1; RSPO; CRISTIN3; RP11-566C13.1
• Gene ID: 284654
• mRNA Refseq: NM_001038633
• Protein Refseq: NP_001033722
• MIM: 609595
• UniProt ID: Q2MKA7
• Chromosome Location: 1p34.2
• Pathway: Wnt signaling network, organism-specific biosystem
• Function: heparin binding; protein binding; receptor binding