Active Recombinant Human PDGFBB Protein (218 aa)

• Cat.No.: PDGFB-153P
• Product Overview: Recombinant Human PDGFBB Protein (218 aa) without tag was expressed in P. pastoris.

Specification

• Species: Human
• Source: P.pastoris
• ProteinLength: 218
• Description: Platelet Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. PDGF which is composed of a dimer of two chains termed the A chain and B chain, can be present as AA or BB homodimers or as an AB heterodimer.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 3 ng/mL, measured by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells, corresponding to a specific activity of > 3.35 units/mg.
• Molecular Mass: 24.3kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
• Endotoxin: < 1 EU/μg, determined by LAL method.
• Purity: > 97% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant human Platelet-Derived Growth Factor-BB (rhPDGF-BB) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhPDGF-BB should be stable up to 4 weeks at 4 centigrade or up to 6 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 10mM acetic acid.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: PDGFB platelet-derived growth factor beta polypeptide [ Homo sapiens ]
• Official Symbol: PDGFB
• Synonyms: PDGFB; platelet-derived growth factor beta polypeptide; platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog), SIS; platelet-derived growth factor subunit B; becaplermin; oncogene SIS; SSV; PDGF-2; PDGF, B chain; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor 2; platelet-derived growth factor B chain; platelet-derived growth factor, B chain; Platelet-derived growth factor, beta polypeptide (oncogene SIS); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; PDGF2; c-sis; FLJ12858
• Gene ID: 5155
• mRNA Refseq: NM_002608
• Protein Refseq: NP_002599
• MIM: 190040
• UniProt ID: P01127