Recombinant Rabbit PDGFB Protein

• Cat.No.: PDGFB-99R
• Product Overview: The Rabbit PDGF-BB recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

Specification

• Species: Rabbit
• Source: Yeast
• Description: PDGF is one of the numerous growth factors that regulate cell growth and division. It plays a significant role in angiogenesis. Platelet-derived growth factor is a dimeric glycoprotein composed of two A (-AA) or two B (-BB) chains or a combination of the two (-AB). Though PDGF is synthesized, stored (in the alpha granules of platelets), and released by platelets upon activation, it is also produced by numerous cells including smooth muscle cells, activated macrophages, and endothelial cells.
• Molecular Mass: 12.2 kDa
• AA Sequence: SLGSPTAAAEPAVIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRHVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKCETVAGVRPA(109)
• Applications: The Rabbit PDGF-BB endotoxin-free recombinant protein can be used in cell culture, as an PDGF-BB ELISA Standard, and as a Western Blot Control.

Gene Information

• Gene Name: PDGFB platelet derived growth factor subunit B [ Oryctolagus cuniculus (rabbit) ]
• Official Symbol: PDGFB
• Synonyms: PDGFB; platelet derived growth factor subunit B; platelet-derived growth factor subunit B; platelet-derived growth factor beta polypeptide
• Gene ID: 100358772
• mRNA Refseq: XM_07342088
• Protein Refseq: XP_017197577