Active Recombinant Human OSM Protein

Cat.No. : OSM-307H
Product Overview : Recombinant Human OSM Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Oncostatin M (OSM) is a multifunctional cytokine that belongs to the Interleukin-6 subfamily. Among the family members, OSM is most closely related to leukemia inhibitory factor (LIF) and it in fact utilizes the LIF receptor in addition to its specific receptor in the human. A biologically active OSM receptor has been previously described that consists of a heterodimer of leukemia inhibitory factor receptor (LIFR) and gp130. OSM is synthesized by stimulated T-cells and monocytes. The effects of OSM on endothelial cells suggest a pro-inflammatory role for OSM and endothelial cells possess a large number of OSM receptors. Recombinant murine OSM contains 181 amino acids and has a molecular mass of 20.4 kDa. It has approximately 48 % and 72 % amino acid sequence identity with human and rat OSM.
Form : Sterile Filtered White lyophil
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/mL, corresponding to a specific activity of > 5.0×10^5 IU/mg.
Molecular Mass : Approximately 25.8 kDa
AA Sequence : AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Endotoxin : Less than 1 EU/ag of rHuOSM as determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL.
Gene Name OSM oncostatin M [ Homo sapiens (human) ]
Official Symbol OSM
Synonyms OSM; oncostatin M; oncostatin-M; MGC20461;
Gene ID 5008
mRNA Refseq NM_020530
Protein Refseq NP_065391
MIM 165095
UniProt ID P13725

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All OSM Products

Required fields are marked with *

My Review for All OSM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon