Active Recombinant Human MYC, His-tagged

Cat.No. : MYC-2522H
Product Overview : Recombinant human myc proto-oncogene protein produced in E.coli is a single non-glycosylated polypeptide with a 8His tag at the C-terminus. It contains 452 (442+10) amino acids having a predicted molecular mass of approximately 50.4kD, but migrates in SDS-PAGE with an apparent molecular mass of 60kD.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Myc (c-Myc) is a regulator gene that codes for a transcription factor. The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation.
Form : 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA
Bio-activity : c-Myc protein is a multi-functional protein involved in cell cycle progression, apoptosis, cellular transformation and transcriptional regulation. Recombinant c-Myc protein is ideal for the studies of protein-protein interactions and other related function assays.
AA Sequence : MASMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCS PSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLV SEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSP SSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPH SPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQ RRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA LEHHHHHHHH
Purity : ≥90%, as determined by SDS-PAGE
Usage : FOR RESEARCH ONLY
Storage : The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Gene Name MYC v-myc avian myelocytomatosis viral oncogene homolog [ Homo sapiens ]
Official Symbol MYC
Synonyms MRTL; MYCC; c-Myc; bHLHe39; myc proto-oncogene protein; avian myelocytomatosis viral oncogene homolog; class E basic helix-loop-helix protein 39; myc-related translation/localization regulatory factor; proto-oncogene c-Myc; transcription factor p64; v-myc myelocytomatosis viral oncogene homolog
Gene ID 4609
mRNA Refseq NM_002467
Protein Refseq NP_002458
MIM 190080
UniProt ID P01106
Chromosome Location 8q24.21
Pathway Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Apoptosis, organism-specific biosystem
Function DNA binding; E-box binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MYC Products

Required fields are marked with *

My Review for All MYC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon