Active Recombinant Full Length Human MYC Protein, C-Flag-tagged

• Cat.No.: MYC-757HFL
• Product Overview: Recombinant Full Length Human MYC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: ELISA binding assay
  EMSA assay
  ELISA capture for autoantibodies
• Molecular Mass: 50.4 kDa
• AA Sequence: LDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFEL LPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFI KNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVF PYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVV SVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQ ISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
  VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Stem cell relevant signaling - Wnt Signaling pathway, Transcription Factors
• Protein Pathways: Acute myeloid leukemia, Bladder cancer, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Jak-STAT signaling pathway, MAPK signaling pathway, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway, Thyroid cancer, Wnt signaling pathway
• Full Length: Full L.

Gene Information

• Gene Name: MYC MYC proto-oncogene, bHLH transcription factor [ Homo sapiens (human) ]
• Official Symbol: MYC
• Synonyms: MRTL; MYCC; c-Myc; bHLHe39
• Gene ID: 4609
• mRNA Refseq: NM_002467.6
• Protein Refseq: NP_002458.2
• MIM: 190080
• UniProt ID: P01106