Active Recombinant Human/Mouse/Rat GDF11 Protein

Cat.No. : GDF11-104H
Product Overview : Recombinant Human/Mouse/Rat GDF11 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Growth differentiation factor 11 (GDF-11), also known as bone morphogenetic protein 11 (BMP-11), is a regulator of cell growth and differentiation during muscular and neural development. GDF-11 binds the transforming growth factor-beta receptors ALK4, ALK5, and ALK7 to activate SMAD signaling. In adults, exogenous GDF-11 promotes cardiomyocyte regeneration to reverse age-related cardiac hypertrophy.
Source : E. coli
Species : Human/Mouse/Rat
Bio-activity : Alkaline phosphatase activity in ATDC5 cells, ≤100 ng/mL
Molecular Mass : Dimer, 12.5/24.9 kDa (109/218 aa)
AA Sequence : NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile 10 mM HCl at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name GDF11 growth differentiation factor 11 [ Homo sapiens (human) ]
Official Symbol GDF11
Synonyms GDF11; growth differentiation factor 11; growth/differentiation factor 11; BMP 11; GDF-11; bone morphogenetic protein 11; BMP11; BMP-11;
Gene ID 10220
mRNA Refseq NM_005811
Protein Refseq NP_005802
MIM 603936
UniProt ID O95390

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GDF11 Products

Required fields are marked with *

My Review for All GDF11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon