Recombinant Human GDF11 Protein, GST-tagged
Cat.No. : | GDF11-4820H |
Product Overview : | Human GDF11 partial ORF ( NP_005802, 310 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice and Xenopus suggest that this protein is involved in mesodermal formation and neurogenesis during embryonic development. [provided by RefSeq |
Molecular Mass : | 36.52 kDa |
AA Sequence : | ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GDF11 growth differentiation factor 11 [ Homo sapiens ] |
Official Symbol | GDF11 |
Synonyms | GDF11; growth differentiation factor 11; growth/differentiation factor 11; BMP 11; GDF-11; bone morphogenetic protein 11; BMP11; BMP-11; |
Gene ID | 10220 |
mRNA Refseq | NM_005811 |
Protein Refseq | NP_005802 |
MIM | 603936 |
UniProt ID | O95390 |
◆ Recombinant Proteins | ||
Gdf11-1080R | Active Recombinant Rat Gdf11 protein | +Inquiry |
GDF11-103H | Recombinant Active Human GDF11 Protein, His-tagged(C-ter) | +Inquiry |
GDF11-242 | Recombinant Human Growth Differentiation Factor 11 | +Inquiry |
GDF11-6284M | Recombinant Mouse GDF11 Protein | +Inquiry |
GDF11-4820H | Recombinant Human GDF11 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF11 Products
Required fields are marked with *
My Review for All GDF11 Products
Required fields are marked with *
0
Inquiry Basket