Active Recombinant Human LR3IGF1 Protein (Receptor Grade)

• Cat.No.: IGF1-339I
• Product Overview: Recombinant Human LR3IGF1 Protein (Receptor Grade) without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: IGF-1 is a well-characterized basic peptide secreted by the liver that circulates in the blood. It has growth-regulating, insulin-like, mitogenic activities. IGF-1 is a growth factor that has a major, but not absolute, dependence on somatotropin. It is believed to be mainly active in adults in contrast to IGF-2, which is also a major fetal growth factor. Human Long R3 Insulin-like Growth Factor-1 (rhLR3IGF-1) contains an 83 amino acid analog of human IGF-I. Compared to the complete human IGF-I sequence, an addition of the rhLR3IGF-1 includes the substitution of an Arg for the Glu at position 3 (hence R3)and a13 amino acid extension peptide at the N-terminus. An enhanced potency is due to the markedly decreased binding of human Long-R3-IGF-I to IGF binding proteins which normally inhibit the biological actions of IGFs. RhLR3IGF-1 is properly folded under oxidizing conditions and then purified by proprietary chromatographic techniques.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 10 ng/mL, measured by the dose-dependantproliferation of CHO cells, corresponding to a specific activity of >1.0 × 10^5 units/mg.
• Molecular Mass: 9.1±0.9 KDa, observed by reducing SDS-PAGE.
• AA Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Endotoxin: < 1 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE.
• Storage: Lyophilized recombinant human Long R3Insulin-like Growth Factor-1 (rhLR3IGF-1) remains stable up to 6 months at -80 centigrade from date of receipt. Stock solution of peptide can be stored at least 3 months at -20 centigrade. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized after dissolved in 48%acetonitrile and 0.1% TFA
• Reconstitution: Reconstituted in 10mM HCl at 1mg/ml. Use a 0.22 μm membrane for filter Sterilization.

Gene Information

• Gene Name: IGF1 insulin like growth factor 1 [ Homo sapiens (human) ]
• Official Symbol: IGF1
• Synonyms: IGF1; insulin like growth factor 1; IGF; MGF; IGFI; IGF-I; insulin-like growth factor I; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor IB; mechano growth factor; somatomedin-C
• Gene ID: 3479
• mRNA Refseq: NM_000618
• Protein Refseq: NP_000609
• MIM: 147440
• UniProt ID: P05019