Active Recombinant Human INHBB Protein

• Cat.No.: INHBB-956H
• Product Overview: Recombinant Human INHBB was expressed in Hi-5 insect cells.

Specification

• Species: Human
• Source: Hi-5 Insect Cells
• Tag: Non
• Description: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
• Bio-activity: ED50 was determined by its ability to inhibit the proliferation of murine MPC-11 cells is less than or equal to 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg.
• Molecular Mass: 25.6 kDa
• AA Sequence: GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: INHBB inhibin, beta B [ Homo sapiens ]
• Official Symbol: INHBB
• Synonyms: INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939
• Gene ID: 3625
• mRNA Refseq: NM_002193
• Protein Refseq: NP_002184
• MIM: 147390
• UniProt ID: P09529