Recombinant human Activin B
Cat.No. : | INHBB-1545H |
Product Overview : | Recombinant human Activin B is a βB subunit single chain containing 123 amino residues and a molecular weight of 14 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | Non |
Description : | Activins are homodimers or heterodimers of the various β subunit isoforms, belonging to the TGF-beta family. Mature Activin B has two chains of 123 amino acids residues (betaB-betaB). Activin exhibits a wide range of biological activities, including mesoderm induction, neural cell differentiation, bone remodelling, haematopoiesis, and reproductive physiology. Activins plays a key role in the production and regulation of hormones such as FSH, LH, GnRH and ACTH. Inhibins/Activins are protein that are formed by the dimerization of two subunits, i. e. an α (alpha) with either beta A (βA) - Inhibin A or beta B (βB) - Inhibin B. The subunits betaA and betaB can also form homodimers or heterodimers called Activin: Activin A (betaA -betaA), Activin B (betaB -betaB) and Activin AB (betaA -betaB). The Activin gene family comprises the additional, but poorly characterized members" Activin betaC (βC), beta D (βD) and beta E (βE). As with other members of the super-family, Activins interact with two types of cell surface trans-membrane receptors (Types I and II) which have intrinsic serine/threonine kinase activities in their cytoplasmic domains, Activin type 1 receptors, ACVR1, ACVR1B, ACVR1C and Activin type 2 receptors, ACVR2A, ACVR2B. |
Form : | Recombinant human Activin B is lyophilized from Tris HCl 0.05M buffer at pH 7.4. |
Molecular Mass : | 14 kDa |
AA Sequence : | HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQ YRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA |
Endotoxin : | < 0.04="" eu/μg="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Storage : | This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
Reconstitution : | Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. At higher concentration the solubility may be reduced and multimers generated. Optimal concentration should be determined for specific application and cell lines. |
Gene Name | INHBB inhibin, beta B [ Homo sapiens ] |
Official Symbol | INHBB |
Synonyms | INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939; |
Gene ID | 3625 |
mRNA Refseq | NM_002193 |
Protein Refseq | NP_002184 |
MIM | 147390 |
UniProt ID | P09529 |
Chromosome Location | 2cen-q13 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Glycoprotein hormones, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peptide hormone biosynthesis, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; |
Function | cytokine activity; growth factor activity; hormone activity; host cell surface receptor binding; protein binding; protein homodimerization activity; |
◆ Recombinant Proteins | ||
INHBB-5118H | Recombinant Human INHBB Protein, GST-tagged | +Inquiry |
Inhbb-1765M | Recombinant Mouse Inhbb protein, His-tagged | +Inquiry |
INHBB-138H | Recombinant Human INHBB, Animal Free | +Inquiry |
Inhbb-64M | Active Recombinant Mouse Inhbb Protein (Gly297-Ala411), C-His tagged, Animal-free, Carrier-free | +Inquiry |
INHBB-1766P | Recombinant Pig INHBB protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBB-2612HCL | Recombinant Human INHBB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INHBB Products
Required fields are marked with *
My Review for All INHBB Products
Required fields are marked with *
0
Inquiry Basket