Active Recombinant Human IL6R Protein (350 aa), N-His-tagged

• Cat.No.: IL6R-139I
• Product Overview: Recombinant human Soluble IL-6 Receptor Alpha (rhsIL-6R alpha) with an N-terminal His tag produced in Sf9 insect cells is a single glycosylated polypeptide chain containing 350 amino acids. A fully biologically active molecule, rhsIL-6R alpha has a molecular mass of 50kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: Sf9 Cells
• Protein Length: 350
• Description: Interleukin-6 Receptor (IL-6R) is a single trans-membrane protein that is the receptor for Interleukin-6 (IL-6). IL-6R forms a hexameric complex upon binding 2 molecules of IL-6 and two molecules of glycoprotein 130 (gp130) which activates intracellular JAK/STAT pathways. Although the normal form of IL-6R is the membrane-bound 80 kDa subunit, a soluble form of IL-6R (sIL-6R) can be generated physiologically by limited proteolysis or alternative splicing. sIL-6R binds to both IL-6 and gp130 generating intracellular signaling. In the immune system, sIL-6R is produced by both naïve and memory CD4 T-cells and strongly augments IL-6 ligand's induction of Th-17 cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 50 ng/mL, measured by the cytotoxicity assay using M1 cells in presence of 10 ng/mL of human IL-6, corresponding to a specific activity of > 2 × 10^4 units/mg.
• Molecular Mass: 50 kDa, observed by reducing SDS-PAGE.
• AA Sequence: HHHHHHDDDDKLAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant human Soluble IL-6 Receptor Alpha (rhsIL-6R alpha) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhsIL-6R alpha remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: IL6R interleukin 6 receptor [ Homo sapiens (human) ]
• Official Symbol: IL6R
• Synonyms: IL6R; interleukin 6 receptor; IL6Q; gp80; CD126; HIES5; IL-6R; IL6RA; IL6RQ; IL-1Ra; IL-6RA; IL6QTL; IL-6R-1; interleukin-6 receptor subunit alphaCD126 antigenIL-6 receptor subunit alphamembrane glycoprotein 80
• Gene ID: 3570
• mRNA Refseq: NM_000565
• Protein Refseq: NP_000556
• MIM: 147880
• UniProt ID: P08887