Active Recombinant Human IL6
Cat.No. : | IL6-23H |
Product Overview : | Recombinant Human IL6 is a 20 to 28 kDa globular protein consisting of 212 amino acid residues. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Description : | This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. |
Form : | 0.22 um filtered solution in 20 mM TRIS*HCl buffer pH 7.2 |
Bio-activity : | ED50 < 1 ng/ml, The activity was determined by the dose dependent stimulation of the proliferation of human TF-1 cells (human erythroleukemic indicator cell line) |
Molecular Mass : | 21-23 kDA, glycosylated |
AA Sequence : | APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCF QSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLT KLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Endotoxin : | < 1.0 EU per 1 μg of the protein by the LAL method. |
Purity : | >95%, Determined by SDS-PAGE under reducing conditions and visualized by silver stain. |
Gene Name | IL6 interleukin 6 [ Homo sapiens (human) ] |
Official Symbol | IL6 |
Synonyms | HGF; BSF2; HSF; IFNB2; IL-6; CDF; BSF-2; B-cell stimulatory factor 2; CTL differentiation factor; Hybridoma growth factor; Interferon beta-2; Interleukin-6 precursor; interleukin 6 (interferon, beta 2); IL6 |
Gene ID | 3569 |
mRNA Refseq | NM_000600 |
Protein Refseq | NP_000591 |
MIM | 147620 |
UniProt ID | P05231 |
Chromosome Location | 7p21 |
Pathway | ARMS-mediated activation; ATF-2 transcription factor network; Chagas disease (American trypanosomiasis) |
Function | Cytokine activity, Interleukin-6 receptor binding, Protein binding; interleukin-6 receptor binding |
◆ Recombinant Proteins | ||
IL6-236I | Active Recombinant Human IL6 Protein | +Inquiry |
IL6-44H | Recombinant Human IL6 Protein | +Inquiry |
Il6-113M | Active Recombinant Mouse Il6 Protein | +Inquiry |
IL6-211P | Recombinant Active Pig IL6 Protein, His-tagged(C-ter) | +Inquiry |
IL6-5309H | Recombinant Human Interleukin 6 (interferon, beta 2), HQ-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *
0
Inquiry Basket