Recombinant Human IL6, StrepII-tagged

• Cat.No.: IL6-264H
• Product Overview: Purified, full-length human recombinant IL6 or Interleukin 6 protein (amino acids 30-212, 183 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 23.7 kDa. (Accession NP_000591.1; UniProt P05231)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 30-212, 183 a.a.
• Description: IL6 is a cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. It plays an essential role in the final differentiation of B-cells into Ig-secreting cells and is involved in lymphocyte and monocyte differentiation. In addition, it induces myeloma and plasmacytoma growth and nerve cells differentiation. IL6 acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS as well as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEY LQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ]
• Official Symbol: IL6
• Synonyms: IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6
• Gene ID: 3569
• mRNA Refseq: NM_000600
• Protein Refseq: NP_000591
• MIM: 147620
• UniProt ID: P05231
• Chromosome Location: 7p21-p15
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem
• Function: cytokine activity; cytokine activity; growth factor activity; interleukin-6 receptor binding; contributes_to interleukin-6 receptor binding; interleukin-6 receptor binding