Active Recombinant Human IL4R Protein
Cat.No. : | IL4R-177I |
Product Overview : | Recombinant Human IL4R Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Description : | Interleukin-4 Receptor, also known as IL-4RA and CD124, is a transmembrane glycoprotein belonging to the class I receptor family. It is highly expressed by activated T-cells. IL-4RA couples with γ chain to form the type I receptor for IL-4. The extracellular domain of IL-4RA binds to IL-4 and antagonizes its activity. IL-4RA plays an important role in Th2 cell differentiation, Ig class switching and alternative macrophage activation. It has also been implicated in allergic inflammation, tumor progression and atherogenesis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 70 ng/mL, measured in a neutralization assay using TF-1 cells in the presence of 0.5 ng/mL h-IL-4. |
Molecular Mass : | 40-45 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Human Interleukin-4 Receptor remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-4 Receptor should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IL4R interleukin 4 receptor [ Homo sapiens ] |
Official Symbol | IL4R |
Synonyms | IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; CD124; IL-4 receptor subunit alpha; interleukin-4 receptor alpha chain; IL4RA; IL-4RA; |
Gene ID | 3566 |
mRNA Refseq | NM_000418 |
Protein Refseq | NP_000409 |
MIM | 147781 |
UniProt ID | P24394 |
◆ Recombinant Proteins | ||
IL4R-2037H | Recombinant Human IL4R protein, His-tagged | +Inquiry |
IL4R-4280H | Recombinant Human IL4R Protein (Met1-His232), C-His tagged | +Inquiry |
IL4R-1382C | Acitve Recombinant Cynomolgus IL4R protein(Met1-Arg232), hFc-tagged | +Inquiry |
IL4R-2437P | Recombinant Pig IL4R Protein (33-240 aa), His-sumostar-tagged | +Inquiry |
IL4R-587HB | Recombinant Human IL4R protein(Met1-His232), His-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4R-2719HCL | Recombinant Human IL4R cell lysate | +Inquiry |
IL4R-1051RCL | Recombinant Rat IL4R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4R Products
Required fields are marked with *
My Review for All IL4R Products
Required fields are marked with *
0
Inquiry Basket