Active Recombinant Human IL4R Protein

• Cat.No.: IL4R-177I
• Product Overview: Recombinant Human IL4R Protein without tag was expressed in HEK 293.

Specification

• Species: Human
• Source: HEK293
• Description: Interleukin-4 Receptor, also known as IL-4RA and CD124, is a transmembrane glycoprotein belonging to the class I receptor family. It is highly expressed by activated T-cells. IL-4RA couples with γ chain to form the type I receptor for IL-4. The extracellular domain of IL-4RA binds to IL-4 and antagonizes its activity. IL-4RA plays an important role in Th2 cell differentiation, Ig class switching and alternative macrophage activation. It has also been implicated in allergic inflammation, tumor progression and atherogenesis.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 70 ng/mL, measured in a neutralization assay using TF-1 cells in the presence of 0.5 ng/mL h-IL-4.
• Molecular Mass: 40-45 kDa, observed by reducing SDS-PAGE.
• AA Sequence: GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Human Interleukin-4 Receptor remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-4 Receptor should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL4R interleukin 4 receptor [ Homo sapiens ]
• Official Symbol: IL4R
• Synonyms: IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; CD124; IL-4 receptor subunit alpha; interleukin-4 receptor alpha chain; IL4RA; IL-4RA
• Gene ID: 3566
• mRNA Refseq: NM_000418
• Protein Refseq: NP_000409
• MIM: 147781
• UniProt ID: P24394