Recombinant Human IL4R protein, His-tagged
Cat.No. : | IL4R-3234H |
Product Overview : | Recombinant Human IL4R protein(P24394)(24-232aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-232aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
Gene Name | IL4R interleukin 4 receptor [ Homo sapiens ] |
Official Symbol | IL4R |
Synonyms | IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; CD124; IL-4 receptor subunit alpha; interleukin-4 receptor alpha chain; IL4RA; IL-4RA; |
Gene ID | 3566 |
mRNA Refseq | NM_000418 |
Protein Refseq | NP_000409 |
MIM | 147781 |
UniProt ID | P24394 |
◆ Recombinant Proteins | ||
IL4R-18C | Active Recombinant Cynomolgus IL4R protein, His-tagged | +Inquiry |
IL4R-01H | Active Recombinant Human IL4R Protein | +Inquiry |
IL4R-051H | Active Recombinant Human IL4R protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
RFL13636MF | Recombinant Full Length Mouse Interleukin-4 Receptor Subunit Alpha(Il4R) Protein, His-Tagged | +Inquiry |
IL4R-5180H | Recombinant Human IL4R Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4R-1051RCL | Recombinant Rat IL4R cell lysate | +Inquiry |
IL4R-2719HCL | Recombinant Human IL4R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4R Products
Required fields are marked with *
My Review for All IL4R Products
Required fields are marked with *
0
Inquiry Basket