Recombinant Human IL4R protein, His-tagged

• Cat.No.: IL4R-3234H
• Product Overview: Recombinant Human IL4R protein(P24394)(24-232aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 24-232aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.8 kDa
• AASequence: GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: IL4R interleukin 4 receptor [ Homo sapiens ]
• Official Symbol: IL4R
• Synonyms: IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; CD124; IL-4 receptor subunit alpha; interleukin-4 receptor alpha chain; IL4RA; IL-4RA
• Gene ID: 3566
• mRNA Refseq: NM_000418
• Protein Refseq: NP_000409
• MIM: 147781
• UniProt ID: P24394