Active Recombinant Human IL18BP Protein

• Cat.No.: IL18BP-75H
• Product Overview: Recombinant Human IL18BP Protein without tag wass expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: The protein encoded by this gene functions as an inhibitor of the proinflammatory cytokine, IL18. It binds IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses. This protein is constitutively expressed and secreted in mononuclear cells. Elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Bio-activity: ED50 < 30 ng/mL, measured in a bioassay using KG-1 cells in the presence of 50 ng/mL Human IL-18.
• Molecular Mass: 42-44 kDa, observed by reducing SDS-PAGE.
• AA Sequence: TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
• Endotoxin: < 0.2 EU/μg determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Human IL-18BP remains stable up to 6 months at lower than -70 centigrade from date of receipt. Upon reconstitution, Human IL-18BP should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL18BP interleukin 18 binding protein [ Homo sapiens (human) ]
• Official Symbol: IL18BP
• Synonyms: IL18BP; interleukin 18 binding protein; FVH; IL18BPa; interleukin-18-binding protein; MC51L-53L-54L homolog gene product; tadekinig-alfa
• Gene ID: 10068
• mRNA Refseq: NM_173044
• Protein Refseq: NP_766632
• MIM: 604113
• UniProt ID: O95998