Active Recombinant Human IL17F Protein

• Cat.No.: IL17F-143H
• Product Overview: Recombinant Human IL17F Protein without tag was expressed in E. coli.

Specification

• Description: Interleukin 17F (IL-17F), a member of the IL-17 cytokine family, is secreted by activated CD4+ T cells and monocytes.
• Source: E. coli
• Species: Human
• Bio-activity: Production of IL-6 from mouse 3T3 cells, ≤100 ng/mL; ≥1.0 x 10^4 units/mg
• AA Sequence: MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution:
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature

Gene Information

• Gene Name: IL17F interleukin 17F [ Homo sapiens (human) ]
• Official Symbol: IL17F
• Synonyms: IL17F; interleukin 17F; interleukin-17F; IL 17F; ML 1; ML1; IL-24; cytokine ML-1; mutant IL-17F; interleukin-24; ML-1; CANDF6; IL-17F
• Gene ID: 112744
• mRNA Refseq: NM_052872
• Protein Refseq: NP_443104
• MIM: 606496
• UniProt ID: Q96PD4