Active Recombinant Human IL17F Protein
Cat.No. : | IL17F-143H |
Product Overview : | Recombinant Human IL17F Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interleukin 17F (IL-17F), a member of the IL-17 cytokine family, is secreted by activated CD4+ T cells and monocytes. |
Bio-activity : | Production of IL-6 from mouse 3T3 cells, ≤100 ng/mL; ≥1.0 x 10^4 units/mg |
AA Sequence : | MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Gene Name | IL17F interleukin 17F [ Homo sapiens (human) ] |
Official Symbol | IL17F |
Synonyms | IL17F; interleukin 17F; interleukin-17F; IL 17F; ML 1; ML1; IL-24; cytokine ML-1; mutant IL-17F; interleukin-24; ML-1; CANDF6; IL-17F; |
Gene ID | 112744 |
mRNA Refseq | NM_052872 |
Protein Refseq | NP_443104 |
MIM | 606496 |
UniProt ID | Q96PD4 |
◆ Recombinant Proteins | ||
Il17f-152M | Recombinant Active Mouse IL17F Protein, His-tagged(C-ter) | +Inquiry |
Il17f-1118R | Active Recombinant Rat Il17f Protein, His-tagged | +Inquiry |
IL17F-2684R | Recombinant Rat IL17F Protein, His (Fc)-Avi-tagged | +Inquiry |
IL17F-129H | Active Recombinant Human IL17F protein | +Inquiry |
Il17f-642R | Active Recombinant Rat Il17f | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17F-2045HCL | Recombinant Human IL17F cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17F Products
Required fields are marked with *
My Review for All IL17F Products
Required fields are marked with *
0
Inquiry Basket