Recombinant Active Human IL17F Protein, His-tagged(C-ter)

• Cat.No.: IL17F-151H
• Product Overview: Recombinant Active Human IL17F Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. [provided by RefSeq, Jul 2008]
• Source: E. coli
• Species: Human
• Tag: His
• Form: Powder
• Bio-activity: Determined by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is < 20 ng/mL.
• AA Sequence: MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: 20 mM Sodium acetate (pH 4.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: IL17F interleukin 17F [ Homo sapiens ]
• Official Symbol: IL17F
• Synonyms: IL17F; interleukin 17F; interleukin-17F; IL 17F; ML 1; ML1; IL-24; cytokine ML-1; mutant IL-17F; interleukin-24; ML-1; CANDF6; IL-17F
• Gene ID: 112744
• mRNA Refseq: NM_052872
• Protein Refseq: NP_443104
• MIM: 606496
• UniProt ID: Q96PD4