Active Recombinant Human IGF2 Protein

• Cat.No.: IGF2-122H
• Product Overview: Recombinant Human IGF2 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Insulin-like growth factor II (IGF-II) is an important fetal growth hormone made by theca cells during gestation. IGF-II engages the IGF-I receptor (IGF1R) to mediate embryonic growth. IGF-II also binds the sink IGF-II receptor (IGF2R) leading to IGF-II degradation.
• Bio-activity: FDC-P1 cell proliferation, ≤15 ng/mL; ≥6.7 x 10^4 units/mg
• Molecular Mass: Monomer, 7.5 kDa (67 aa)
• AA Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens (human) ]
• Official Symbol: IGF2
• Synonyms: IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734; somatomedin-A; insulin-like growth factor type 2; IGF-II; PP9974; C11orf43; FLJ22066
• Gene ID: 3481
• mRNA Refseq: NM_000612
• Protein Refseq: NP_000603
• MIM: 147470
• UniProt ID: P01344