Recombinant Active Mouse IGF2 Protein, His-tagged(N-ter)

• Cat.No.: Igf2-130M
• Product Overview: Recombinant Active Mouse IGF2 Protein with His tag (N-ter) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]
• Form: Powder
• Bio-activity: Determined by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is < 6 ng/mL. The specific activity of recombinant mouse IGF-II is > 1.5 x 10^5 IU/mg.
• AA Sequence: YGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: Igf2 insulin-like growth factor 2 [ Mus musculus ]
• Official Symbol: Igf2
• Synonyms: IGF2; insulin-like growth factor 2; insulin-like growth factor II; multiplication-stimulating polypeptide; Mpr; M6pr; Peg2; Igf-2; Igf-II; AL033362
• Gene ID: 16002
• mRNA Refseq: NM_001122736
• Protein Refseq: NP_001116208