Active Recombinant Human IFNG Protein
Cat.No. : | IFNG-115H |
Product Overview : | Recombinant Human IFNG Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interferon gamma (IFN-γ) is a type II interferon that is critical during adaptive and innate immune responses to infection. IFN-γ is produced by T cells and natural killer cells following antigen-specific activation. IFN-γ binds IFN-γ receptors (IFN-γ R1 and IFN-γ R2), which are expressed on most immune cells, to activate the JAK-STAT pathway. IFN-γ-induced signaling increases the expression of class 1 major histocompatibility complex (MHC) molecules. Human IFN-γ is not cross-reactive with mouse IFN-γ. |
Bio-activity : | Activity of HEK-Blue™ IFN-γ Cells, ≤0.7 ng/mL; ≥1.4 x 10^6 units/mg |
Molecular Mass : | Monomer, 16.9 kDa (144 aa) |
AA Sequence : | MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IFNG interferon, gamma [ Homo sapiens (human) ] |
Official Symbol | IFNG |
Synonyms | IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI; |
Gene ID | 3458 |
mRNA Refseq | NM_000619 |
Protein Refseq | NP_000610 |
MIM | 147570 |
UniProt ID | P01579 |
◆ Recombinant Proteins | ||
IFNG-145H | Recombinant Human Interferon, Gamma, His-tagged | +Inquiry |
IFNG-116H | Recombinant Human IFNG protein | +Inquiry |
Ifng-379I | Active Recombinant Mouse Ifng Protein (134 aa) | +Inquiry |
IFNG-09H | Recombinant Human Interferon Gamma | +Inquiry |
IFNG-2997R | Recombinant Rat IFNG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket