Active Recombinant Human FST Protein

Cat.No. : FST-101H
Product Overview : Recombinant Human FST Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Follistatin is an autocrine, activin-binding protein that is ubiquitously expressed with highest expression levels being in the ovary and skin. Follistatin negatively regulates the signaling of transforming growth factor beta (TGF-β) family members, such as activin, bone morphogenetic proteins (BMPs), myostatin, growth differentiation factor 11 (GDF-11), and TGF-β1. Follistatin functions as an antagonist by binding TGF-β family members to block interaction with their signaling receptors. Follistatin also inhibits the secretion of follicle-stimulating hormone (FSH) from the anterior pituitary.
Bio-activity : Neutralization of Human Activin A induced cytotoxicity of MPC-11 cells, ≤200 ng/mL; ≥5.0 x 10^3 units/mg
Molecular Mass : Monomer, 31.7 kDa (289 aa)
AA Sequence : MGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name FST follistatin [ Homo sapiens (human) ]
Official Symbol FST
Synonyms FST; follistatin; FS; activin-binding protein; follistatin isoform FST317;
Gene ID 10468
mRNA Refseq NM_006350
Protein Refseq NP_006341
MIM 136470
UniProt ID P19883

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FST Products

Required fields are marked with *

My Review for All FST Products

Required fields are marked with *

0

Inquiry Basket

cartIcon