Recombinant Mouse FST Protein

Cat.No. : FST-102M
Product Overview : Recombinant Mouse FST Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Follistatin is an autocrine, activin-binding protein that is ubiquitously expressed with highest expression levels being in the ovary and skin. Follistatin negatively regulates the signaling of transforming growth factor beta (TGF-β) family members, such as activin, bone morphogenetic proteins (BMPs), myostatin, growth differentiation factor 11 (GDF-11), and TGF-β1. Follistatin functions as an antagonist by binding TGF-β family members to block interaction with their signaling receptors. Follistatin also inhibits the secretion of follicle-stimulating hormone (FSH) from the anterior pituitary.
Source : E. coli
Species : Mouse
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 31.6 kDa (289 aa)
AA Sequence : MGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
Endotoxin : ≤5 EUs/μg, Kinetic LAL
Purity : ≥90%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Fst follistatin [ Mus musculus (house mouse) ]
Official Symbol FST
Synonyms FST; follistatin; FS; activin-binding protein; AL033346;
Gene ID 14313
mRNA Refseq NM_008046
Protein Refseq NP_032072
UniProt ID P47931

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FST Products

Required fields are marked with *

My Review for All FST Products

Required fields are marked with *

0

Inquiry Basket

cartIcon