| Species : |
Human |
| Source : |
E.coli |
| Protein Length : |
134-288, 154 amino acid |
| Description : |
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. |
| Form : |
Lyophilized |
| Bio-activity : |
ED50= 0.1-1.0 ng/mL as determined by the dose dependent proliferation of NIH 3T3 cells. |
| Molecular Mass : |
17.3 kDa |
| AA Sequence : |
AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Endotoxin : |
< 0.01 ng/μg cytokine as determined by the LAL assay |
| Purity : |
> 98% by SDS-PAGE |
| Usage : |
Useful for cell culture and for the study of signaling pathways. |
| Storage : |
Upon receipt, it should be stored immediately at -20 to -80 centigrade. Lyophilized bFGF is stable at -20 to -80 centigrade for up to 16 months. |
| Storage Buffer : |
Sterile filtered through a 0.22 micron filter and lyophilized from Tris buffer (10 mM Tris pH7.5, 150 mM NaCl). |
| Reconstitution : |
Centrifuge vial before opening. It is recommended to reconstitute bFGF in sterile 10 mM Tris-HCl, pH 7.5 to yield a stock solution of 0.1 mg/mL of bFGF. It is stable for up to 6 months when stored at -20 centigrade and up to 12 months when stored at -80 centigrade. Multiple freeze/thaw cycles will result in significant loss of activity. |
| Shipping : |
The product is shipped at ambient temperature with ice bags. |
