Active Recombinant Mouse Fgf2 Protein

• Cat.No.: Fgf2-061M
• Product Overview: Purified recombinant protein of Mouse fibroblast growth factor 2 (Fgf2) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Broad expression in mammary gland adult (RPKM 4.1), ovary adult (RPKM 3.7) and 18 other tissues.
• Bio-activity: Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 10^6 units/mg.
• Molecular Mass: 15.9 kDa
• AA Sequence: PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Fgf2 fibroblast growth factor 2 [ Mus musculus (house mouse) ]
• Official Symbol: Fgf2
• Synonyms: Fgf2; fibroblast growth factor 2; Fgfb; bFGF; Fgf-2; fibroblast growth factor 2; HBGF-2; basic fibroblast growth factor; heparin-binding growth factor 2
• Gene ID: 14173
• mRNA Refseq: NM_008006
• Protein Refseq: NP_032032
• UniProt ID: P15655