Recombinant Chicken FGF2 protein, His-tagged

• Cat.No.: FGF2-6739C
• Product Overview: Recombinant Chicken FGF2 protein(NP_990764.1)(Phe29~Gly143), fused to His-tag, was expressed in E. coli.

Specification

• Species: Chicken
• Source: E.coli
• Tag: His
• Protein Length: Phe29~Gly143
• Form: 100mMNaHCO3, 500mMNaCl, pH8.3, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
• Molecular Mass: 17/20kDa(Analysis of differences refer to the manual)
• AA Sequence: FKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTG
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Purity: > 95%
• Applications: Positive Control; Immunogen; SDS-PAGE; WB.
  If bio-activity of the protein is needed, please check active protein.
• Notes: The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
• Reconstitution: Reconstitute in 100mM NaHCO3, 500mM NaCl (pH8.3) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: FGF2 fibroblast growth factor 2 [ Gallus gallus (chicken) ]
• Official Symbol: FGF2
• Synonyms: B-FGF; BFGF; FGFB; HBGH-2; Basic Fibroblast Growth Factor; Heparin-binding growth factor 2
• Gene ID: 396413
• mRNA Refseq: NM_205433.1
• Protein Refseq: NP_990764.1
• UniProt ID: P48800