Recombinant Chicken FGF2 protein, His-tagged
Cat.No. : | FGF2-6739C |
Product Overview : | Recombinant Chicken FGF2 protein(NP_990764.1)(Phe29~Gly143), fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Phe29~Gly143 |
Form : | 100mMNaHCO3, 500mMNaCl, pH8.3, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
Molecular Mass : | 17/20kDa(Analysis of differences refer to the manual) |
AA Sequence : | FKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTG |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 95% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. If bio-activity of the protein is needed, please check active protein. |
Notes : | The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
Reconstitution : | Reconstitute in 100mM NaHCO3, 500mM NaCl (pH8.3) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | FGF2 fibroblast growth factor 2 [ Gallus gallus (chicken) ] |
Official Symbol | FGF2 |
Synonyms | B-FGF; BFGF; FGFB; HBGH-2; Basic Fibroblast Growth Factor; Heparin-binding growth factor 2 |
Gene ID | 396413 |
mRNA Refseq | NM_205433.1 |
Protein Refseq | NP_990764.1 |
UniProt ID | P48800 |
◆ Recombinant Proteins | ||
FGF2-402F | Active Recombinant Human FGF2 Protein (145 aa) | +Inquiry |
FGF2-482H | Recombinant Human FGF2 protein | +Inquiry |
Fgf2-5419M | Recombinant Mouse Fgf2 Protein (Met1-Ser154) | +Inquiry |
FGF2-049H | Active Recombinant Human fibroblast growth factor 2 Protein, His&Flag tagged | +Inquiry |
FGF2-1487H | Recombinant Human FGF2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGF2-26551TH | Native Human FGF2 | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
0
Inquiry Basket