Active Recombinant Human cTnI Protein

• Cat.No.: Tnni3-1003H
• Product Overview: Recombinant Human cardiac troponin I antigen with a C-terminal histidine tag. Predicted molecular weight: 26 kDa.

Specification

• Description: Troponins form a complex of three regulatory proteins (troponin C, I and T) that are integral to muscle contraction in skeletal and cardiac muscles. Serum cardiac troponin tests can be used to help diagnose several different heart disorders, especially myocardial infarction.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Lyophilized
• Bio-activity: Anti-h cTnI 9701: + Anti-h cTnI 9703: + Anti-h cTnI 9705: + Anti-h cTnI 9707: + Anti-h cTnI 9708: + Anti-h cTnI 9709: +
• Molecular Mass: 26 kDa
• AA Sequence: MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQE LEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTK NITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKED MEKENREVGDWRKNIDALSGMEGRKKKFESESSGGGSLEHHHHHHHH
• Storage: 2–8centigrade
• Concentration: 0.5 mg/ml when reconstituted with 200 µl of deionized water
• Storage Buffer: 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 8 M urea; containing 3 % sucrose, 2 % Dmannitol, and 0.01 % Tween 20 as stabilizers
• Reconstitution: Reconstitute the lyophilized protein with 200 µl of deionized water

Gene Information

• Gene Name: TNNI3 troponin I type 3 (cardiac) [ Homo sapiens ]
• Official Symbol: Tnni3
• Synonyms: TNNI3; troponin I type 3 (cardiac); troponin I, cardiac; troponin I, cardiac muscle; CMH7; TNNC1; RCM1; cTnI; CMD2A; CMD1FF; MGC116817
• Gene ID: 7137
• mRNA Refseq: NM_000363
• Protein Refseq: NP_000354
• MIM: 191044
• UniProt ID: P19429