Recombinant Mouse Tert Protein, His-SUMO-tagged
Cat.No. : | Tnni3-1388M |
Product Overview : | Recombinant Mouse Tnni3 Protein (2-211aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-211 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 40.1 kDa |
AA Sequence : | ADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQEMEREAEERRG EKGRVLRTRCQPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFK RPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALSGMEGRKKKFEG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Tnni3 troponin I, cardiac 3 [ Mus musculus (house mouse) ] |
Official Symbol | Tnni3 |
Synonyms | Tn1; cTnI |
Gene ID | 21954 |
mRNA Refseq | NM_009406.4 |
Protein Refseq | NP_033432.1 |
UniProt ID | P48787 |
◆ Recombinant Proteins | ||
TNNI3-79H | Recombinant Human TNNI3 | +Inquiry |
TNNI3-27665H | Recombinant Human TNNI3, His-tagged | +Inquiry |
TNNI3-178D | Recombinant Dog TNNI3 protein, His/T7-tagged | +Inquiry |
TNNI3-535C | Recombinant Cat TNNI3 protein, His-tagged | +Inquiry |
TNNI3-2254H | Recombinant Human TNNI3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
TNNI3-221H | Native Human TNNI3 | +Inquiry |
TNNI3-223H | Native Human Troponin I Type 3 (Cardiac) | +Inquiry |
TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNI3-1803HCL | Recombinant Human TNNI3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnni3 Products
Required fields are marked with *
My Review for All Tnni3 Products
Required fields are marked with *
0
Inquiry Basket