Recombinant Mouse Tert Protein, His-SUMO-tagged
Cat.No. : | Tnni3-1388M |
Product Overview : | Recombinant Mouse Tnni3 Protein (2-211aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Mouse |
Tag : | His&SUMO |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 40.1 kDa |
AA Sequence : | ADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQEMEREAEERRG EKGRVLRTRCQPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFK RPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALSGMEGRKKKFEG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Protein length : | 2-211 a.a. |
Gene Name | Tnni3 troponin I, cardiac 3 [ Mus musculus (house mouse) ] |
Official Symbol | Tnni3 |
Synonyms | Tn1; cTnI |
Gene ID | 21954 |
mRNA Refseq | NM_009406.4 |
Protein Refseq | NP_033432.1 |
UniProt ID | P48787 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tnni3 Products
Required fields are marked with *
My Review for All Tnni3 Products
Required fields are marked with *
0
Inquiry Basket