Active Recombinant Human CNR1 Full Length Transmembrane protein, His-tagged

• Cat.No.: CNR1-718H
• Product Overview: Recombinant Human CNR1 protein(P21554)(1-472aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-472aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human CNR1 at 10 μg/mL can bind Anti-CNR1 recombinant antibody, the EC50 is 41.72-63.54 ng/mL.
• Molecular Mass: 54.6 kDa
• AA Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CNR1 cannabinoid receptor 1 (brain) [ Homo sapiens ]
• Official Symbol: CNR1
• Synonyms: CNR1; cannabinoid receptor 1 (brain); CNR; cannabinoid receptor 1; CANN6; CB R; CB1; CB1A; CB1K5; central cannabinoid receptor; CB-R; CB1R
• Gene ID: 1268
• mRNA Refseq: NM_001160226
• Protein Refseq: NP_001153698
• MIM: 114610
• UniProt ID: P21554