Recombinant Full Length Taeniopygia Guttata Cannabinoid Receptor 1(Cnr1) Protein, His-Tagged
Cat.No. : | RFL28531TF |
Product Overview : | Recombinant Full Length Taeniopygia guttata Cannabinoid receptor 1(CNR1) Protein (P56971) (1-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Taeniopygia guttata (Zebra finch) (Poephila guttata) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-473) |
Form : | Lyophilized powder |
AA Sequence : | MKSILDGLADTTFRTITTDLLYVGSNDIQYEDMKGDMASKLGYYPQKFPLSSFRGDPFQE KMTGGDDSLLSIIPSEQVNITEFYNKSLSTFKDNEENIQCGENFMDMECFMILNPSQQLA IAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFH VFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFC VMWTIAIVIAVLPLLGWNCKKLNSVCSDIFPLIDETYLMFWIGVTSILLLFIVYAYMYIL WKAHSHAVRMLQRGTQKSIIIQSTEDGKVQITRPDQTRMDIRLAKTLVLILVVLIICWGP LLAIMVYDVFGKMNKLIKTIFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPTCEGT AQPLDNSMESDCQHKHANNAGNVHRAAESCIKSTVKIAKVTMSVSTDTTAEAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNR1 |
Synonyms | CNR1; Cannabinoid receptor 1; CB-R; CB1 |
UniProt ID | P56971 |
◆ Recombinant Proteins | ||
Fyb-3117M | Recombinant Mouse Fyb Protein, Myc/DDK-tagged | +Inquiry |
IL21R.2-6308Z | Recombinant Zebrafish IL21R.2 | +Inquiry |
CD28-151H | Recombinant Human CD28 Protein, His-tagged | +Inquiry |
Cxcl9-69M | Active Recombinant Mouse Cxcl9 Protein (Thr22-Thr126), N-His tagged, Animal-free, Carrier-free | +Inquiry |
IL6-654D | Recombinant Dog IL6 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
SAA-256H | Native Human Serum amyloid A Protein | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
PerCP-139 | Native Dinophyceae sp. Peridinin-chlorophyll-protein complex protein | +Inquiry |
imALB-36H | Native Human Ischemia Modified Albumin (IMA) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM174-987HCL | Recombinant Human TMEM174 293 Cell Lysate | +Inquiry |
BMP1-8436HCL | Recombinant Human BMP1 293 Cell Lysate | +Inquiry |
TNFRSF11B-2176HCL | Recombinant Human TNFRSF11B cell lysate | +Inquiry |
UTS2D-1900HCL | Recombinant Human UTS2D cell lysate | +Inquiry |
CLDN5-7461HCL | Recombinant Human CLDN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNR1 Products
Required fields are marked with *
My Review for All CNR1 Products
Required fields are marked with *
0
Inquiry Basket