Recombinant Full Length Cat Cannabinoid Receptor 1(Cnr1) Protein, His-Tagged
Cat.No. : | RFL32060FF |
Product Overview : | Recombinant Full Length Cat Cannabinoid receptor 1(CNR1) Protein (O02777) (1-472aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Felis catus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-472) |
Form : | Lyophilized powder |
AA Sequence : | MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE KMTAGDNSQLVPADQVNITEFYNKSLSSYKENEENIQCGENFMDMECFMILNPSQQLAIA VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVF HRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKKIVTRPKAVVAFCLM WTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWK AHIHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ PLDNSMGDSDCLHKHANNTANVHRAAENCIKNTVQIAKVTISVSTNTSAKAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNR1 |
Synonyms | CNR1; Cannabinoid receptor 1; CB-R; CB1 |
UniProt ID | O02777 |
◆ Recombinant Proteins | ||
PRKACB-4083HF | Active Recombinant Full Length Human PRKACB Protein, GST-tagged | +Inquiry |
PRELID2-2907H | Recombinant Human PRELID2 Protein, His-tagged | +Inquiry |
Tnfrsf17-2266MAF555 | Recombinant Mouse Tnfrsf17 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
RFL36965MF | Recombinant Full Length Mouse Voltage-Dependent Calcium Channel Gamma-7 Subunit(Cacng7) Protein, His-Tagged | +Inquiry |
ZMYM4-3858Z | Recombinant Zebrafish ZMYM4 | +Inquiry |
◆ Native Proteins | ||
LDH3-222H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Lectin-1837S | Active Native Sambucus Nigra Lectin Protein, Agarose bound | +Inquiry |
Collagen Type I & III-06M | Native Mouse Collagen Type I and III Protein | +Inquiry |
Immunoglobulin G1-81H | Native Human Immunoglobulin G1 | +Inquiry |
Lectin-1814P | Active Native Peanut Lectin Protein, Cy3 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FECH-6267HCL | Recombinant Human FECH 293 Cell Lysate | +Inquiry |
ZNF580-44HCL | Recombinant Human ZNF580 293 Cell Lysate | +Inquiry |
FXYD4-6099HCL | Recombinant Human FXYD4 293 Cell Lysate | +Inquiry |
TMEM35-956HCL | Recombinant Human TMEM35 293 Cell Lysate | +Inquiry |
PROX1-2830HCL | Recombinant Human PROX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNR1 Products
Required fields are marked with *
My Review for All CNR1 Products
Required fields are marked with *
0
Inquiry Basket