Recombinant Full Length Mouse Cannabinoid Receptor 1(Cnr1) Protein, His-Tagged
Cat.No. : | RFL8888MF |
Product Overview : | Recombinant Full Length Mouse Cannabinoid receptor 1(Cnr1) Protein (P47746) (1-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-473) |
Form : | Lyophilized powder |
AA Sequence : | MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAI AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cnr1 |
Synonyms | Cnr1; Cannabinoid receptor 1; CB-R; CB1; Brain-type cannabinoid receptor |
UniProt ID | P47746 |
◆ Recombinant Proteins | ||
CPSF4-7579H | Recombinant Human CPSF4, His-tagged | +Inquiry |
CSRP1-674H | Recombinant Human CSRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YPHE-3303B | Recombinant Bacillus subtilis YPHE protein, His-tagged | +Inquiry |
RFL538GF | Recombinant Full Length Geobacillus Kaustophilus Upf0295 Protein Gk0479(Gk0479) Protein, His-Tagged | +Inquiry |
GRIPAP1-2709R | Recombinant Rat GRIPAP1 Protein | +Inquiry |
◆ Native Proteins | ||
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
C7-56H | Native Human Complement C7 | +Inquiry |
KLK4-239R | Native Rat Kallikrein | +Inquiry |
ung-8332E | Native E.coli ung | +Inquiry |
COL2A1-1647H | Native Human COL2A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LACC1-8298HCL | Recombinant Human C13orf31 293 Cell Lysate | +Inquiry |
Fetal Umbilical Cord-179H | Human Fetal Umbilical Cord Lysate | +Inquiry |
C8orf74-7947HCL | Recombinant Human C8orf74 293 Cell Lysate | +Inquiry |
CSH1-2206HCL | Recombinant Human CSH1 cell lysate | +Inquiry |
ZSWIM1-9183HCL | Recombinant Human ZSWIM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cnr1 Products
Required fields are marked with *
My Review for All Cnr1 Products
Required fields are marked with *
0
Inquiry Basket