Active Recombinant Human CCL18 Protein (69 aa)
Cat.No. : | CCL18-071C |
Product Overview : | Recombinant Human CCL18 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 69 |
Description : | CCL18, is a novel CC chemokine that is highly homologous to MIP-1α (61% amino acid sequence identity). CCL18 cDNA encodes an 89 aa residue precursor protein with a 20 aa putative signal peptide that is cleaved to generate a 69 aa residue mature protein which lacks potential glycosylation sites. In vitro, CCL18 mRNA expression is induced in alternatively activated macrophages by Th2 cytokines such as IL-4, IL-10 and IL-13, and inhibited by IFN-γ. CCL18 mRNA is also expressed by GM-CSF/IL-4-induced monocyte-derived dendritic cells. In vivo, CCL18 is highly expressed in lung and placenta but is not expressed in epidermal Langerhans cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 1.0 -10.0 ng/mL, corresponding to a Specific Activity of >1 × 10^5 IU/mg. |
Molecular Mass : | 7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids. |
AA Sequence : | AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
Endotoxin : | Less than 1 EU/mg of rHuMIP-4/CCL18 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL18 chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) [ Homo sapiens ] |
Official Symbol | CCL18 |
Synonyms | CCL18; chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated); SCYA18, small inducible cytokine subfamily A (Cys Cys), member 18, pulmonary and activation regulated; C-C motif chemokine 18; AMAC 1; CKb7; DC CK1; DCCK1; MIP 4; PARC; CC chemokine PARC; CC chemokine ligand 18; chemokine (C-C), dendritic; dendritic cell chemokine 1; small inducible cytokine A18; small-inducible cytokine A18; macrophage inflammatory protein 4; pulmonary and activation-regulated chemokine; alternative macrophage activation-associated CC chemokine 1; small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary and activation-regulated; AMAC1; MIP-4; AMAC-1; DC-CK1; SCYA18; |
Gene ID | 6362 |
mRNA Refseq | NM_002988 |
Protein Refseq | NP_002979 |
MIM | 603757 |
UniProt ID | P55774 |
◆ Recombinant Proteins | ||
CCL18-509R | Recombinant Rhesus Macaque CCL18 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL18-11H | Recombinant Human CCL18 Protein | +Inquiry |
CCL18-253H | Active Recombinant Human Chemokine (C-C Motif) Ligand 18, HIgG1 Fc-tagged | +Inquiry |
CCL18-113H | Active Human CCL18, Biotin-tagged | +Inquiry |
CCL18-30163TH | Recombinant Human CCL18, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL18 Products
Required fields are marked with *
My Review for All CCL18 Products
Required fields are marked with *
0
Inquiry Basket