Recombinant Human CCL18, His-tagged

• Cat.No.: CCL18-30163TH
• Product Overview: Recombinant fragment of Human Macrophage Inflammatory Protein 4 , with an N terminal His tag, 93aa, 10.4kDa inclusive of tag.

Specification

• Description: This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses.
• Protein length: 68 amino acids
• Conjugation: HIS
• Molecular Weight: 10.400kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 10mM Sodium citrate, pH 3.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Gene Information

• Gene Name: CCL18 chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) [ Homo sapiens ]
• Official Symbol: CCL18
• Synonyms: CCL18; chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated); SCYA18, small inducible cytokine subfamily A (Cys Cys), member 18, pulmonary and activation regulated; C-C motif chemokine 18; AMAC 1; CKb7; DC CK1; DCCK1; MIP 4; PARC
• Gene ID: 6362
• mRNA Refseq: NM_002988
• Protein Refseq: NP_002979
• MIM: 603757
• Uniprot ID: P55774
• Chromosome Location: 17q11.2
• Pathway: Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem
• Function: chemokine activity; protein binding