Active Recombinant Human Amphiregulin
Cat.No. : | AREG-134H |
Product Overview : | Recombinant Human Amphiregulin encoding the human Amphiregulin protein sequence (containing the signal peptide, N- and C-terminal propeptide and the mature Amphiregulin sequence) was expressed in modifiedhuman 293 cells. Proteolytic processing of the expressed membrane-bound precursor protein generates mature soluble Amphiregulin. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Description : | Amphiregulin is an epidermal growth factor (EGF)-related glycoprotein that is expressed in a variety of tissues including ovary, placenta, lung, kidney, stomach, colon and breast. As an EGF-related growth factor, Amphiregulin is involved in the differentiation and proliferation of a wide range of cell types and these actions are mediated through binding to the EGF receptor. |
Amino Acid Sequence : | VVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMK. |
Molecular Mass : | Under reducing conditions Amphiregulin (mature form) migrates as a broad band between 17.6 and 23.4 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Amphiregulin polypeptide that has a predicted monomeric molecular mass of 9.07 kDa. |
% Carbohydrate : | Purified Amphiregulin (mature form) consists of 25–50% carbohydrate by weight. |
Glycosylation : | Amphiregulin (mature form) contains N- and O-linked oligosaccharides. |
Purity : | >95%, as determined by SDS-PAGE, visualized by Coomassie Brilliant Blue. |
Formulation : | When reconstituted in 0.5 ml sterile 5mM acetic acid, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile 5mM acetic acid be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Activity : | The ED50of Amphiregulin (mature form) is typically 10–15 ng/ml as measured in a cell proliferation assay using the murine Balb/3T3 fibroblast cell line. |
Publications : |
Epidermal Growth Factor Receptor (EGFR) Signaling Is a Key Mediator of Hormone-Induced Leukocyte Infiltration in the Pubertal Female Mammary Gland (2014)
|
Gene Name | EG amphiregulin [ Homo sapiens ] |
Synonyms | AREG; amphiregulin; AR; SDGF; CRDGF; MGC13647; schwannoma-derived growth factor; colorectum cell-derived growth factor; OTTHUMP00000160473 |
Gene ID | 374 |
mRNA Refseq | NM_001657 |
Protein Refseq | NP_001648 |
UniProt ID | P15514 |
Chromosome Location | 4q13-q21 |
MIM | 104640 |
Pathway | ErbB signaling pathway |
Function | cytokine activity; growth factor activity |
◆ Recombinant Proteins | ||
RFL-15364MF | Recombinant Full Length Mouse Amphiregulin(Areg) Protein, His-Tagged | +Inquiry |
AREG-515C | Recombinant Cattle AREG protein, His & GST-tagged | +Inquiry |
AREG-918H | Recombinant Human AREG Protein, GST-His-tagged | +Inquiry |
AREG-002H | Active Recombinant Human AREG Protein | +Inquiry |
AREG-0293H | Recombinant Human AREG Protein (Ser101-Lys187), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AREG-8762HCL | Recombinant Human AREG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AREG Products
Required fields are marked with *
My Review for All AREG Products
Required fields are marked with *
0
Inquiry Basket