Active Recombinant Human AREG Protein

• Cat.No.: AREG-195A
• Product Overview: Recombinant Human AREG Protein without tag was expressed in HEK 293.

Specification

• Species: Human
• Source: HEK293
• Description: Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.2 ng/mL, measured in a cell proliferation assay using 3T3 cells.
• Molecular Mass: 15~20 kDa, observed by reducing SDS-PAGE.
• AA Sequence: SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: AREG amphiregulin [ Homo sapiens ]
• Official Symbol: AREG
• Synonyms: AREG; amphiregulin; schwannoma derived growth factor, SDGF; schwannoma-derived growth factor; colorectum cell-derived growth factor; AR; SDGF; AREGB; CRDGF; MGC13647
• Gene ID: 374
• mRNA Refseq: NM_001657
• Protein Refseq: NP_001648
• MIM: 104640
• UniProt ID: P15514