Active Recombinant Full Length Human VHL Protein, C-Flag-tagged
Cat.No. : | VHL-259HFL |
Product Overview : | Recombinant Full Length Human VHL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Von Hippel-Lindau syndrome (VHL) is a dominantly inherited familial cancer syndrome predisposing to a variety of malignant and benign tumors. A germline mutation of this gene is the basis of familial inheritance of VHL syndrome. The protein encoded by this gene is a component of the protein complex that includes elongin B, elongin C, and cullin-2, and possesses ubiquitin ligase E3 activity. This protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. RNA polymerase II subunit POLR2G/RPB7 is also reported to be a target of this protein. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Binding assay |
Molecular Mass : | 24 kDa |
AA Sequence : | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSRE PSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSL NVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQR MGDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | VHL von Hippel-Lindau tumor suppressor [ Homo sapiens (human) ] |
Official Symbol | VHL |
Synonyms | RCA1; VHL1; pVHL; HRCA1 |
Gene ID | 7428 |
mRNA Refseq | NM_000551.4 |
Protein Refseq | NP_000542.1 |
MIM | 608537 |
UniProt ID | P40337 |
◆ Recombinant Proteins | ||
Vhl-6921M | Recombinant Mouse Vhl Protein, Myc/DDK-tagged | +Inquiry |
VHL-5643H | Recombinant Human VHL protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
VHL-336HFL | Recombinant Full Length Human VHL Protein, N-His-tagged | +Inquiry |
VHL-693H | Recombinant Human VHL Protein, His-tagged | +Inquiry |
VHL-6521R | Recombinant Rat VHL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VHL-410HCL | Recombinant Human VHL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VHL Products
Required fields are marked with *
My Review for All VHL Products
Required fields are marked with *
0
Inquiry Basket