Recombinant Human VHL protein, MBP&His-Avi-tagged, Biotinylated
Cat.No. : | VHL-5643H |
Product Overview : | Biotinylated Recombinant Human VHL protein(P40337)(1-213aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Avi&His&MBP |
Protein Length : | 1-213aa |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 71.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD |
Gene Name | VHL von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | VHL |
Synonyms | VHL; von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase; von Hippel Lindau syndrome , von Hippel Lindau tumor suppressor; von Hippel-Lindau disease tumor suppressor; VHL1; protein G7; elongin binding protein; RCA1; pVHL; HRCA1; |
Gene ID | 7428 |
mRNA Refseq | NM_000551 |
Protein Refseq | NP_000542 |
MIM | 608537 |
UniProt ID | P40337 |
◆ Recombinant Proteins | ||
VHL-6177R | Recombinant Rat VHL Protein, His (Fc)-Avi-tagged | +Inquiry |
VHL-29832TH | Recombinant Human VHL, His-tagged | +Inquiry |
VHL-10015M | Recombinant Mouse VHL Protein, His (Fc)-Avi-tagged | +Inquiry |
VHL-28605TH | Recombinant Human VHL, His-tagged | +Inquiry |
VHL-2338H | Recombinant Human VHL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VHL-410HCL | Recombinant Human VHL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VHL Products
Required fields are marked with *
My Review for All VHL Products
Required fields are marked with *
0
Inquiry Basket