Active Recombinant Full Length Human RNASE1 Protein, C-Flag-tagged

• Cat.No.: RNASE1-02HFL
• Product Overview: Recombinant Full Length Human RNASE1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Enzyme activity
  In vivo treatment
  Cell treatment
  Binding assay
  In vivo treatment
• Molecular Mass: 14.5 kDa
• AA Sequence: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKP VNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEG
  SPYVPVHFDASVEDSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Secreted Protein, Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: RNASE1 ribonuclease A family member 1, pancreatic [ Homo sapiens (human) ]
• Official Symbol: RNASE1
• Synonyms: RAC1; RIB1; RNS1
• Gene ID: 6035
• mRNA Refseq: NM_198235.3
• Protein Refseq: NP_937878.1
• MIM: 180440
• UniProt ID: P07998