Active GMP Recombinant Human IFNG Protein

• Cat.No.: IFNG-157HG
• Product Overview: Recombinant Human IFNG (Gln24-Gln166) was produced in HEK293 cell in an animal component free process under cGMP guidelines.

Specification

• Description: IFNγ is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them, leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNγ synthesis is induced by IL-2, FGF-basic, and EGF.
• Source: HEK293 cell
• Species: Human
• Form: Lyophilized.
• Bio-activity: Measured by a viral resistance assay using VSV-WISH cells.
  Specific Activity is greater than 1.5 x 10^7 IU/mg.
• AA Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQS IQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRK RSQMLFRGRRASQ
• Residual Host Cell DNA Content: <10pg/mg
• Residual Host Cell Protein Content: <1ug/mg
• Endotoxin: <0.1EU/ug
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Usage: Recommemnd working concentration: 50ng/ml or 1000U/ml
• Storage: Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration >100μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
• Tag: Non
• Protein length: 24-166 a.a.

Gene Information

• Gene Name: IFNG interferon, gamma [ Homo sapiens ]
• Official Symbol: IFNG
• Synonyms: IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI
• Gene ID: 3458
• mRNA Refseq: NM_000619
• Protein Refseq: NP_000610
• MIM: 147570
• UniProt ID: P01579