Recombinant Zebrafish IL26 Protein, His-tagged

• Cat.No.: IL26-61Z
• Product Overview: Recombinant Zebrafish IL26 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Description: Is expressed in gill and intestine. Orthologous to human IL26 (interleukin 26).
• Source: E. coli
• Species: Zebrafish
• Tag: His
• Form: Supplied as a 0.2 μm filtered solution in PBS, 1 mM DTT (pH8.0).
• Molecular Mass: ~21 kDa
• AA Sequence: MHHHHHHMRILIPFTLCALLCWSEGHKQEECLKREIRLPMIREMLSMSQDIHKSLPRDNKPFHRILGKLKKCKELNVPDFKRVLEIYDEHVFEKMWDELPTQFIDYFKRLKGIMQNCATEGKPTQSR CAKEKLKKFEQTLMKLQPDGKTKALSEFHSVLLWISSGMDRRKTYKKIH
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.15 mg/ml

Gene Information

• Gene Name: il26 interleukin 26 [ Danio rerio (zebrafish) ]
• Official Symbol: IL26
• Synonyms: zgc:194942
• Gene ID: 553971
• mRNA Refseq: NM_001020799
• Protein Refseq: NP_001018635
• UniProt ID: Q5TLE5