Recombinant Zebrafish IFN gamma 1 Protein, 146
Cat.No. : | IFNG-13Z |
Product Overview : | Zebrafish IFN gamma 1-1 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zebrafish |
Source : | Yeast |
Description : | Interferon-gamma (IFN-gamma) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops. |
Molecular Mass : | 17.4 kDa |
AA Sequence : | YRFRRSRSENPILNTNIEKLKTHYNTLAKDWVGKSVFVSHLDQLNSKPTCTCQAVLLEGMLSIYEDIFQDMMNKSDNKEVRDDLKKVIHEVKNLKHKYNEEHKLWRELQDIHSVKAKNGTIQERALNDFLKVYYRASTEKRHLHMS |
Applications : | The zebrafish IFN gamma endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control. |
Official Symbol | IFNG |
Synonyms | IFNG; IFN gamma 1-1 |
◆ Recombinant Proteins | ||
IFNG-804S | Recombinant Sheep IFNG protein, His-tagged | +Inquiry |
IFNG-685H | Recombinant Human Interferon, Gamma, HQ-tagged | +Inquiry |
Ifng-7469R | Active Recombinant Rat Ifng protein, hFc-tagged | +Inquiry |
IFNG-1165R | Active Recombinant Rhesus Protein | +Inquiry |
IFNG-801D | Recombinant Dog IFNG protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket