Recombinant Zebrafish IFN gamma 1 Protein, 146

• Cat.No.: IFNG-13Z
• Product Overview: Zebrafish IFN gamma 1-1 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

Specification

• Description: Interferon-gamma (IFN-gamma) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops.
• Source: Yeast
• Species: Zebrafish
• Molecular Mass: 17.4 kDa
• AA Sequence: YRFRRSRSENPILNTNIEKLKTHYNTLAKDWVGKSVFVSHLDQLNSKPTCTCQAVLLEGMLSIYEDIFQDMMNKSDNKEVRDDLKKVIHEVKNLKHKYNEEHKLWRELQDIHSVKAKNGTIQERALNDFLKVYYRASTEKRHLHMS
• Applications: The zebrafish IFN gamma endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control.

Gene Information

• Official Symbol: IFNG
• Synonyms: IFNG; IFN gamma 1-1