Recombinant Yellow Fluorescent Protein, His-tagged
Cat.No. : | YFP-149 |
Product Overview : | Recombinant Yellow Fluorescent Protein, fused to His-tag, was expressed in HEK293. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Tag : | His |
Form : | Lyophilized from 0.22 um filtered solution in 50mM Tris, 300mM NaCl, pH 8.5. |
Molecular Mass : | The protein has a calculated MW of 27.4 kDa. |
AA Sequence : | MRGSGSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYLLEHHHHHH |
Purity : | >90%,by SDS-PAGE |
Storage : | For long term storage, the product should be stored at lyophilized state at -20ºC or lower. Please avoid repeated freeze-thaw cycles. |
Concentration : | 8.7mg/mL |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All YFP Products
Required fields are marked with *
My Review for All YFP Products
Required fields are marked with *
0
Inquiry Basket