Recombinant VSIV(strain San Juan) Matrix protein, His-Myc-tagged
Cat.No. : | Matrix-792V |
Product Overview : | Recombinant VSIV(strain San Juan) Matrix protein(P03519)(1-229aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VSIV |
Source : | E.coli |
Tag : | His&Myc |
ProteinLength : | 1-229aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.5 kDa |
AA Sequence : | MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKFFFTVKLTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWILDSVSHFK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
Lepr-03M | Recombinant Mouse Lepr(Leu22-Gly839) Protein, C-Fc-tagged | +Inquiry |
GALNT5-13139H | Recombinant Human GALNT5, His-tagged | +Inquiry |
RFL4420MF | Recombinant Full Length Mouse Trimeric Intracellular Cation Channel Type A(Tmem38A) Protein, His-Tagged | +Inquiry |
DEFA6-122HF | Recombinant Full Length Human DEFA6 Protein | +Inquiry |
H1-2701H | Recombinant Human H1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Mucin-078P | Native Porcine Mucin Protein | +Inquiry |
Hemocyanin-30S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free | +Inquiry |
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
Collagen-60H | Native Human Collagen Type II | +Inquiry |
Dimer-110H | Native Human D-Dimer Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RABL2A-2570HCL | Recombinant Human RABL2A 293 Cell Lysate | +Inquiry |
STK10-1711HCL | Recombinant Human STK10 cell lysate | +Inquiry |
TCEAL6-1750HCL | Recombinant Human TCEAL6 cell lysate | +Inquiry |
SOSTDC1-1567HCL | Recombinant Human SOSTDC1 293 Cell Lysate | +Inquiry |
FEZF2-6258HCL | Recombinant Human FEZF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Matrix Products
Required fields are marked with *
My Review for All Matrix Products
Required fields are marked with *
0
Inquiry Basket